C3AR1 (Human) Recombinant Protein
  • C3AR1 (Human) Recombinant Protein

C3AR1 (Human) Recombinant Protein

Ref: AB-H00000719-G01
C3AR1 (Human) Recombinant Protein

Información del producto

Human C3AR1 full-length ORF (NP_004045.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 10 ug
Gene Name C3AR1
Gene Alias AZ3B|C3AR|HNFAG09
Gene Description complement component 3a receptor 1
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MASFSAETNSTDLLSQPWNEPPVILSMVILSLTFLLGLPGNGLVLWVAGLKMQRTVNTIWFLHLTLADLLCCLSLPFSLAHLALQGQWPYGRFLCKLIPSIIVLNMFASVFLLTAISLDRCLVVFKPIWCQNHRNVGMACSICGCIWVVAFVMCIPVFVYREIFTTDNHNRCGYKFGLSSSLDYPDFYGDPLENRSLENIVQPPGEMNDRLDPSSFQTNDHPWTVPTVFQPQTFQRPSADSLPRGSARLTSQNLY
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 719

Enviar uma mensagem


C3AR1 (Human) Recombinant Protein

C3AR1 (Human) Recombinant Protein