CEACAM1 (Human) Recombinant Protein
  • CEACAM1 (Human) Recombinant Protein

CEACAM1 (Human) Recombinant Protein

Ref: AB-H00000634-G01
CEACAM1 (Human) Recombinant Protein

Información del producto

Human CEACAM1 full-length ORF (NP_001020083.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 10 ug
Gene Name CEACAM1
Gene Alias BGP|BGP1|BGPI
Gene Description carcinoembryonic antigen-related cell adhesion molecule 1 (biliary glycoprotein)
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MGHLSAPLHRVRVPWQGLLLTASLLTFWNPPTTAQLTTESMPFNVAEGKEVLLLVHNLPQQLFGYSWYKGERVDGNRQIVGYAIGTQQATPGPANSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHVYPELPKPSISSNNSNPVEDKDAVAFTCEPETQDTTYLWWINNQSLPVSPRLQLSNGNRTLTLLSVTRNDTGPYECEIQNPVSANRSDPVTLNVTYGPDTPTISPSDTYYRPGANL
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 634

Enviar uma mensagem


CEACAM1 (Human) Recombinant Protein

CEACAM1 (Human) Recombinant Protein