ATP1A4 (Human) Recombinant Protein
  • ATP1A4 (Human) Recombinant Protein

ATP1A4 (Human) Recombinant Protein

Ref: AB-H00000480-G01
ATP1A4 (Human) Recombinant Protein

Información del producto

Human ATP1A4 full-length ORF (NP_653300.2) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 10 ug
Gene Name ATP1A4
Gene Alias ATP1A1|ATP1AL2|MGC25056
Gene Description ATPase, Na+/K+ transporting, alpha 4 polypeptide
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MGLWGKKGTVAPHDQSPRRRPKKGLIKKKMVKREKQKRNMEELKKEVVMDDHKLTLEELSTKYSVDLTKGHSHQRAKEILTRGGPNTVTPPPTTPEWVKFCKQLFGGFSLLLWTGAILCFVAYSIQIYFNEEPTKDNLYLSIVLSVVVIVTGCFSYYQEAKSSKIMESFKNMVPQQALVIRGGEKMQINVQEVVLGDLVEIKGGDRVPADLRLISAQGCKVDNSSLTGESEPQSRSPDFTHENPLETRNICFFST
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Gene ID 480

Enviar uma mensagem


ATP1A4 (Human) Recombinant Protein

ATP1A4 (Human) Recombinant Protein