ANPEP (Human) Recombinant Protein
  • ANPEP (Human) Recombinant Protein

ANPEP (Human) Recombinant Protein

Ref: AB-H00000290-G01
ANPEP (Human) Recombinant Protein

Información del producto

Human ANPEP full-length ORF (NP_001141.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 10 ug
Gene Name ANPEP
Gene Alias APN|CD13|LAP1|PEPN|gp150|p150
Gene Description alanyl (membrane) aminopeptidase
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MAKGFYISKSLGILGILLGVAAVCTIIALSVVYSQEKNKNANSSPVASTTPSASATTNPASATTLDQSKAWNRYRLPNTLKPDSYQVTLRPYLTPNDRGLYVFKGSSTVRFTCKEATDVIIIHSKKLNYTLSQGHRVVLRGVGGSQPPDIDKTELVEPTEYLVVHLKGSLVKDSQYEMDSEFEGELADDLAGFYRSEYMEGNVRKVVATTQMQAADARKSFPCFDEPAMKAEFNITLIHPKDLTALSNMLPKGPS
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 290

Enviar uma mensagem


ANPEP (Human) Recombinant Protein

ANPEP (Human) Recombinant Protein