ALK (Human) Recombinant Protein
  • ALK (Human) Recombinant Protein

ALK (Human) Recombinant Protein

Ref: AB-H00000238-H01
ALK (Human) Recombinant Protein

Información del producto

Purified ALK (AAI56208.1 400 a.a. - 550 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed in human cells.
Información adicional
Size 25 ug
Gene Name ALK
Gene Alias CD246|Ki-1|TFG/ALK
Gene Description anaplastic lymphoma receptor tyrosine kinase
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Concentration &ge
Application Key WB,ELISA,SDS-PAGE,PI
Immunogen Prot. Seq FRVALEYISSGNRSLSAVDFFALKNCSEGTSPGSKMALQSSFTCWNGTVLQLGQACDFHQDCAQGEDESQMCRKLPVGFYCNFEDGFCGWTQGTLSPHTPQWQVRTLKDARFQDHQDHALLLSTTDVPASESATVTSATFPAPIKSSPCEL
Form Liquid
Antigen species Target species Human
Quality control testing SDS-PAGE and Western Blot
Storage Buffer 100 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM EDTA, and 5 mM desthiobiotin.
Host Human HEK293H cells
Gene ID 238

Enviar uma mensagem


ALK (Human) Recombinant Protein

ALK (Human) Recombinant Protein