ADORA2B (Human) Recombinant Protein
  • ADORA2B (Human) Recombinant Protein

ADORA2B (Human) Recombinant Protein

Ref: AB-H00000136-G01
ADORA2B (Human) Recombinant Protein

Información del producto

Human ADORA2B full-length ORF (ABM82640.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 10 ug
Gene Name ADORA2B
Gene Alias ADORA2
Gene Description adenosine A2b receptor
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MLLETQDALYVALELVIAALSVAGNVLVCAAVGTANTLQTPTNYFLVSLAAADVAVGLFAIPFAITISLGFCTDFYGCLFLACFVLVLTQSSIFSLLAVAVDRYLAICVPLRYKSLVTGTRARGVIAVLWVLAFGIGLTPFLGWNSKDSATNNCTEPWDGTTNESCCLVKCLFENVVPMSYMVYFNFFGCVLPPLLIMLVIYIKIFLVACRQLQRTELMDHSRTTLQREIHAAKSLAMIVGIFALCWLPVHAVNC
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 136

Enviar uma mensagem


ADORA2B (Human) Recombinant Protein

ADORA2B (Human) Recombinant Protein