ADORA2A (Human) Recombinant Protein (P02)
  • ADORA2A (Human) Recombinant Protein (P02)

ADORA2A (Human) Recombinant Protein (P02)

Ref: AB-H00000135-P02
ADORA2A (Human) Recombinant Protein (P02)

Información del producto

Human ADORA2A full-length ORF ( NP_000666.2, 1 a.a. - 412 a.a.) recombinant protein with GST-tag at N-terminal.
Información adicional
Size 2 ug
Gene Name ADORA2A
Gene Alias ADORA2|RDC8|hA2aR
Gene Description adenosine A2a receptor
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA,WB-Re,AP,Array
Immunogen Prot. Seq MPIMGSSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLAIPFAITISTGFCAACHGCLFIACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGTRAKGIIAICWVLSFAIGLTPMLGWNNCGQPKEGKNHSQGCGEGQVACLFEDVVPMNYMVYFNFFACVLVPLLLMLGVYLRIFLAARRQLKQMESQPLPGERARSTLQKEVHAAKSLAIIVGLFALCWLPLHIINCF
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 135

Enviar uma mensagem


ADORA2A (Human) Recombinant Protein (P02)

ADORA2A (Human) Recombinant Protein (P02)