Anti-STRN4 Antibody 25ul
  • Anti-STRN4 Antibody 25ul

Anti-STRN4 Antibody 25ul

Ref: AN-HPA043051-25ul
Anti-STRN4

Información del producto

Polyclonal Antibody against Human STRN4, Gene description: striatin, calmodulin binding protein 4, Alternative Gene Names: ZIN, zinedin, Validated applications: WB, Uniprot ID: Q9NRL3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name STRN4
Gene Description striatin, calmodulin binding protein 4
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB
Sequence GLSGGESLLVKQIEEQIKRNAAGKDGKERLGGSVLGQIPFLQNCEDEDSDEDDELDSVQHKKQRVKLPSKALVPEMEDE
Immunogen GLSGGESLLVKQIEEQIKRNAAGKDGKERLGGSVLGQIPFLQNCEDEDSDEDDELDSVQHKKQRVKLPSKALVPEMEDE
Product Group Polyclonal Antibodies
Alternative Names ZIN, zinedin
Host RABBIT
UniProt ID Q9NRL3
HTS Code 3002150000
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-STRN4 Antibody 25ul

Anti-STRN4 Antibody 25ul