Anti-HSD17B4 Antibody 25ul View larger

Anti-HSD17B4 Antibody 25ul

AN-HPA021311-25ul

New product

Anti-HSD17B4

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 25ul
Gene Name HSD17B4
Gene Description hydroxysteroid (17-beta) dehydrogenase 4
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence ESCEENGGLFEVGAGWIGKLRWERTLGAIVRQKNHPMTPEAVKANWKKICDFENASKPQSIQESTGSIIEVLSK
Immunogen ESCEENGGLFEVGAGWIGKLRWERTLGAIVRQKNHPMTPEAVKANWKKICDFENASKPQSIQESTGSIIEVLSK
Product Group Polyclonal Antibodies
Alternative Names DBP, MFE-2, SDR8C1
Host RABBIT
UniProt ID P51659
HTS Code 3002150000
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

More info

Polyclonal Antibody against Human HSD17B4, Gene description: hydroxysteroid (17-beta) dehydrogenase 4, Alternative Gene Names: DBP, MFE-2, SDR8C1, Validated applications: ICC, IHC, Uniprot ID: P51659, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image