Anti-HOXB9 Antibody 100ul
  • Anti-HOXB9 Antibody 100ul

Anti-HOXB9 Antibody 100ul

Ref: AN-HPA004928-100ul
Anti-HOXB9

Información del producto

Polyclonal Antibody against Human HOXB9, Gene description: homeobox B9, Alternative Gene Names: HOX2, HOX2E, Validated applications: ICC, Uniprot ID: P17482, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name HOXB9
Gene Description homeobox B9
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence SISGTLSSYYVDSIISHESEDAPPAKFPSGQYASSRQPGHAEHLEFPSCSFQPKAPVFGASWAPLSPHASGSLPSVYHPYIQPQGVPPAESRYLRTWLEP
Immunogen SISGTLSSYYVDSIISHESEDAPPAKFPSGQYASSRQPGHAEHLEFPSCSFQPKAPVFGASWAPLSPHASGSLPSVYHPYIQPQGVPPAESRYLRTWLEP
Product Group Polyclonal Antibodies
Alternative Names HOX2, HOX2E
Host RABBIT
UniProt ID P17482
HTS Code 3002150000
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-HOXB9 Antibody 100ul

Anti-HOXB9 Antibody 100ul