Anti-GAPDH Antibody 25ul
  • Anti-GAPDH Antibody 25ul

Anti-GAPDH Antibody 25ul

Ref: AN-HPA061280-25ul
Anti-GAPDH

Información del producto

Polyclonal Antibody against Human GAPDH, Gene description: glyceraldehyde-3-phosphate dehydrogenase, Alternative Gene Names: GAPD, Validated applications: ICC, WB, Uniprot ID: P04406, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name GAPDH
Gene Description glyceraldehyde-3-phosphate dehydrogenase
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, WB
Sequence EKPAKYDDIKKVVKQASEGPLKGILGYTEHQVVSSDFNSDTHSSTFDAG
Immunogen EKPAKYDDIKKVVKQASEGPLKGILGYTEHQVVSSDFNSDTHSSTFDAG
Product Group Polyclonal Antibodies
Alternative Names GAPD
Host RABBIT
UniProt ID P04406
HTS Code 3002150000
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-GAPDH Antibody 25ul

Anti-GAPDH Antibody 25ul