Anti-EBF2 Antibody 25ul
  • Anti-EBF2 Antibody 25ul

Anti-EBF2 Antibody 25ul

Ref: AN-HPA003954-25ul
Anti-EBF2

Información del producto

Polyclonal Antibody against Human EBF2, Gene description: early B cell factor 2, Alternative Gene Names: COE2, FLJ11500, Validated applications: ICC, Uniprot ID: Q9HAK2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name EBF2
Gene Description early B cell factor 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence LPALSSSPAHSGMMGINSYGSQLGVSISESTQGNNQGYIRNTSSISPRGYSSSSTPQQSNYSTSSNSMNGYSNVPMANLGVPGSPGFLNGSPTGSPYGIMSSSPTVGSSSTSSILPFSSSVFPAVKQKSAFAPVIRPQG
Immunogen LPALSSSPAHSGMMGINSYGSQLGVSISESTQGNNQGYIRNTSSISPRGYSSSSTPQQSNYSTSSNSMNGYSNVPMANLGVPGSPGFLNGSPTGSPYGIMSSSPTVGSSSTSSILPFSSSVFPAVKQKSAFAPVIRPQG
Product Group Polyclonal Antibodies
Alternative Names COE2, FLJ11500
Host RABBIT
UniProt ID Q9HAK2
HTS Code 3002150000
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-EBF2 Antibody 25ul

Anti-EBF2 Antibody 25ul