Anti-DOHH Antibody 25ul
  • Anti-DOHH Antibody 25ul

Anti-DOHH Antibody 25ul

Ref: AN-HPA041953-25ul
Anti-DOHH

Información del producto

Polyclonal Antibody against Human DOHH, Gene description: deoxyhypusine hydroxylase/monooxygenase, Alternative Gene Names: HLRC1, MGC4293, Validated applications: IHC, WB, Uniprot ID: Q9BU89, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name DOHH
Gene Description deoxyhypusine hydroxylase/monooxygenase
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence RFRALFTLRGLGGPGAIAWISQAFDDDSALLKHELAYCLGQMQDARAIPMLVDVLQDTRQEPMVRHEAGEALGAIGDPEVLEILKQYSSDP
Immunogen RFRALFTLRGLGGPGAIAWISQAFDDDSALLKHELAYCLGQMQDARAIPMLVDVLQDTRQEPMVRHEAGEALGAIGDPEVLEILKQYSSDP
Product Group Polyclonal Antibodies
Alternative Names HLRC1, MGC4293
Host RABBIT
UniProt ID Q9BU89
HTS Code 3002150000
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-DOHH Antibody 25ul

Anti-DOHH Antibody 25ul