Anti-AQP4 Antibody 100ul
  • Anti-AQP4 Antibody 100ul

Anti-AQP4 Antibody 100ul

Ref: AN-HPA014784-100ul
Anti-AQP4

Información del producto

Polyclonal Antibody against Human AQP4, Gene description: aquaporin 4, Alternative Gene Names: MIWC, Validated applications: IHC, WB, Uniprot ID: P55087, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name AQP4
Gene Description aquaporin 4
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse
Applications IHC, WB
Sequence CPDVEFKRRFKEAFSKAAQQTKGSYMEVEDNRSQVETDDLILKPGVVHVIDVDRGEEKKGKDQSGEVLSSV
Immunogen CPDVEFKRRFKEAFSKAAQQTKGSYMEVEDNRSQVETDDLILKPGVVHVIDVDRGEEKKGKDQSGEVLSSV
Product Group Polyclonal Antibodies
Alternative Names MIWC
Host RABBIT
UniProt ID P55087
HTS Code 3002150000
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-AQP4 Antibody 100ul

Anti-AQP4 Antibody 100ul