Anti-PPP1R3F View larger

Anti-PPP1R3F Antibody 100ul

AN-HPA075936-100ul

New product

Anti-PPP1R3F

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 5 pontos de fidelização. Seu carrinho totalizará 5 pontos de fidelização que podem ser convertidos num vale de desconto de 20.00EUR.


Data sheet

Size 100ul
Gene Name PPP1R3F
Gene Description protein phosphatase 1 regulatory subunit 3F
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross HUMAN
Applications ICC
Sequence EVLQAPAIRIPPSSPLCGLGGSPRDQASGPDASEGATGPFLEPSQQQAEATWGVSSENGGGLEAVSGSEELLGEDTIDQELEQLYLSHLS
Immunogen EVLQAPAIRIPPSSPLCGLGGSPRDQASGPDASEGATGPFLEPSQQQAEATWGVSSENGGGLEAVSGSEELLGEDTIDQELEQLYLSHLS
Product Group Polyclonal Antibodies
Alternative Names Hb2E
Category Polyclonal
Host RABBIT
UniProt ID Q6ZSY5
HTS Code 3002150000
Gene ID 89801
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Aplicativo ICC
Conjugation Unconjugated

More info

Polyclonal Antibody against Human PPP1R3F, Gene description: protein phosphatase 1 regulatory subunit 3F, Alternative Gene Names: Hb2E, Validated applications: ICC, Uniprot ID: Q6ZSY5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image