Anti-TP53RK View larger

Anti-TP53RK Antibody 100ul

AN-HPA075054-100ul

New product

Anti-TP53RK

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 5 pontos de fidelização. Seu carrinho totalizará 5 pontos de fidelização que podem ser convertidos num vale de desconto de 20.00EUR.


Data sheet

Size 100ul
Gene Name TP53RK
Gene Description TP53 regulating kinase
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence FGLSFISALPEDKGVDLYVLEKAFLSTHPNTETVFEAFLKSYSTSSKKARPVLKKLDEVRLRGRKRSMVG
Immunogen FGLSFISALPEDKGVDLYVLEKAFLSTHPNTETVFEAFLKSYSTSSKKARPVLKKLDEVRLRGRKRSMVG
Product Group Polyclonal Antibodies
Alternative Names BUD32, C20orf64, dJ101A2.2, Nori-2p, prpk, TPRKB
Category Polyclonal
Host RABBIT
UniProt ID Q96S44
HTS Code 3002150000
Gene ID 112858
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Aplicativo IHC, WB
Conjugation Unconjugated

More info

Polyclonal Antibody against Human TP53RK, Gene description: TP53 regulating kinase, Alternative Gene Names: BUD32, C20orf64, dJ101A2.2, Nori-2p, prpk, TPRKB, Validated applications: IHC, WB, Uniprot ID: Q96S44, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image