Anti-KCNQ1
  • Anti-KCNQ1

Anti-KCNQ1 Antibody 100ul

Ref: AN-HPA071107-100ul
Anti-KCNQ1

Información del producto

Polyclonal Antibody against Human KCNQ1, Gene description: potassium voltage-gated channel subfamily Q member 1, Alternative Gene Names: JLNS1, KCNA8, KCNA9, Kv7.1, KVLQT1, LQT, LQT1, Validated applications: ICC, Uniprot ID: P51787, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name KCNQ1
Gene Description potassium voltage-gated channel subfamily Q member 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross HUMAN
Applications ICC
Sequence YSQGHLNLMVRIKELQRRLDQSIGKPSLFISVSEKSKDRGSNTIGARLNRVEDKVTQLDQ
Immunogen YSQGHLNLMVRIKELQRRLDQSIGKPSLFISVSEKSKDRGSNTIGARLNRVEDKVTQLDQ
Product Group Polyclonal Antibodies
Alternative Names JLNS1, KCNA8, KCNA9, Kv7.1, KVLQT1, LQT, LQT1
Category Polyclonal
Host RABBIT
UniProt ID P51787
HTS Code 3002150000
Gene ID 3784
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-KCNQ1 Antibody 100ul

Anti-KCNQ1 Antibody 100ul