Anti-TIMP3 View larger

Anti-TIMP3 Antibody 100ul

AN-HPA068391-100ul

New product

Anti-TIMP3

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 5 pontos de fidelização. Seu carrinho totalizará 5 pontos de fidelização que podem ser convertidos num vale de desconto de 20.00EUR.


Data sheet

Size 100ul
Gene Name TIMP3
Gene Description TIMP metallopeptidase inhibitor 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross HUMAN
Applications ICC
Sequence YHLGCNCKIKSCYYLPCFVTSKNECLWTDMLSNFGYPGYQSKHYACIRQKGGYCSWYRGWAPPDKSIINATDP
Immunogen YHLGCNCKIKSCYYLPCFVTSKNECLWTDMLSNFGYPGYQSKHYACIRQKGGYCSWYRGWAPPDKSIINATDP
Product Group Polyclonal Antibodies
Alternative Names SFD
Category Polyclonal
Host RABBIT
UniProt ID P35625
HTS Code 3002150000
Gene ID 7078
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Aplicativo ICC
Conjugation Unconjugated

More info

Polyclonal Antibody against Human TIMP3, Gene description: TIMP metallopeptidase inhibitor 3, Alternative Gene Names: SFD, Validated applications: ICC, Uniprot ID: P35625, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image