Anti-SEC23A View larger

Anti-SEC23A Antibody 100ul

AN-HPA065985-100ul

New product

Anti-SEC23A

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 5 pontos de fidelização. Seu carrinho totalizará 5 pontos de fidelização que podem ser convertidos num vale de desconto de 20.00EUR.


Data sheet

Size 100ul
Gene Name SEC23A
Gene Description SEC23 homolog A, COPII coat complex component
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross HUMAN
Applications ICC
Sequence DLSAKQLQEMLGLSKVPLTQATRGPQVQQPPPSNRFLQPVQ
Immunogen DLSAKQLQEMLGLSKVPLTQATRGPQVQQPPPSNRFLQPVQ
Product Group Polyclonal Antibodies
Category Polyclonal
Host RABBIT
UniProt ID Q15436
HTS Code 3002150000
Gene ID 10484
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Aplicativo ICC
Conjugation Unconjugated

More info

Polyclonal Antibody against Human SEC23A, Gene description: SEC23 homolog A, COPII coat complex component, Validated applications: ICC, Uniprot ID: Q15436, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image