View larger
Anti-ZBTB46 Antibody 100ul
AN-HPA048051-100ul
New product
Anti-ZBTB46
Ao comprar este produto pode ganhar até 5 pontos de fidelização. Seu carrinho totalizará 5 pontos de fidelização que podem ser convertidos num vale de desconto de 20.00EUR.
Data sheet
| Size | 100ul |
| Gene Name | ZBTB46 |
| Gene Description | zinc finger and BTB domain containing 46 |
| Storage Conditions | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Shipping Conditions | Normally shipped at ambient temperature |
| Species Reactivity Cross | Human |
| Applications | WB, ICC |
| Sequence | DLSVTEASSSDSRGERAELYAQVEEGLLGGEASYLGPPLTPEKDDALHQATAVANLRAALMSKNSLLSLKADVLGDDGSLLFEYLPRGAHSLSLNEFTVIRKKFKCPYCSFSAMHQCILKR |
| Immunogen | DLSVTEASSSDSRGERAELYAQVEEGLLGGEASYLGPPLTPEKDDALHQATAVANLRAALMSKNSLLSLKADVLGDDGSLLFEYLPRGAHSLSLNEFTVIRKKFKCPYCSFSAMHQCILKR |
| Product Group | Polyclonal Antibodies |
| Alternative Names | BTBD4, BZEL, FLJ13502, RINZF, ZNF340 |
| Category | Polyclonal |
| Host | RABBIT |
| UniProt ID | Q86UZ6 |
| HTS Code | 3002150000 |
| Gene ID | 140685 |
| Buffer Formulation | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purification | Affinity purified using the PrEST antigen as affinity ligand |
| Iso type | IgG |
| Aplicativo | ICC, WB |
| Conjugation | Unconjugated |
More info
Polyclonal Antibody against Human ZBTB46, Gene description: zinc finger and BTB domain containing 46, Alternative Gene Names: BTBD4, BZEL, FLJ13502, RINZF, ZNF340, Validated applications: ICC, WB, Uniprot ID: Q86UZ6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C." target="_blank">See DataSheet herehttps://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF