Anti-NR5A1
  • Anti-NR5A1

Anti-NR5A1 Antibody 25ul

Ref: AN-HPA079181-25ul
Anti-NR5A1

Información del producto

Polyclonal Antibody against Human NR5A1, Gene description: nuclear receptor subfamily 5 group A member 1, Alternative Gene Names: AD4BP, ELP, FTZ1, FTZF1, hSF-1, SF-1, Validated applications: ICC, Uniprot ID: Q13285, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name NR5A1
Gene Description nuclear receptor subfamily 5 group A member 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence VPELILQLLQLEPDEDQVRARILGCLQEPTKSRPDQPAAFGLLCRMADQT
Immunogen VPELILQLLQLEPDEDQVRARILGCLQEPTKSRPDQPAAFGLLCRMADQT
Product Group Polyclonal Antibodies
Alternative Names AD4BP, ELP, FTZ1, FTZF1, hSF-1, SF-1
Category Polyclonal
Host RABBIT
UniProt ID Q13285
HTS Code 3002150000
Gene ID 2516
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-NR5A1 Antibody 25ul

Anti-NR5A1 Antibody 25ul