Anti-LOXHD1 View larger

Anti-LOXHD1 Antibody 100ul

AN-HPA077128-100ul

New product

Anti-LOXHD1

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 5 pontos de fidelização. Seu carrinho totalizará 5 pontos de fidelização que podem ser convertidos num vale de desconto de 20.00EUR.


Data sheet

Size 100ul
Gene Name LOXHD1
Gene Description lipoxygenase homology domains 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence SPADFWEIALSSKMADVDISTVTGPMADYVQEGPIIPYYVSVTTGKHKDAATDSRAFIFLIGEDDERSKRIWLDYPRGKRGFSRGSV
Immunogen SPADFWEIALSSKMADVDISTVTGPMADYVQEGPIIPYYVSVTTGKHKDAATDSRAFIFLIGEDDERSKRIWLDYPRGKRGFSRGSV
Product Group Polyclonal Antibodies
Alternative Names DFNB77, FLJ32670, LH2D1
Category Polyclonal
Host RABBIT
UniProt ID Q8IVV2
HTS Code 3002150000
Gene ID 125336
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Aplicativo ICC
Conjugation Unconjugated

More info

Polyclonal Antibody against Human LOXHD1, Gene description: lipoxygenase homology domains 1, Alternative Gene Names: DFNB77, FLJ32670, LH2D1, Validated applications: ICC, Uniprot ID: Q8IVV2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image