Anti-KIF22 View larger

Anti-KIF22 Antibody 25ul

AN-HPA075670-25ul

New product

Anti-KIF22

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.


Data sheet

Size 25ul
Gene Name KIF22
Gene Description kinesin family member 22
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence LEPEEKAEDCWELQISPELLAHGRQKILDLLNEGSARDLRSLQRIGPKKAQLIVGWRELHGPFSQVEDLERVEGITGKQMESF
Immunogen LEPEEKAEDCWELQISPELLAHGRQKILDLLNEGSARDLRSLQRIGPKKAQLIVGWRELHGPFSQVEDLERVEGITGKQMESF
Product Group Polyclonal Antibodies
Alternative Names Kid, KNSL4, OBP-1, OBP-2
Category Polyclonal
Host RABBIT
UniProt ID Q14807
HTS Code 3002150000
Gene ID 3835
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Aplicativo IHC, WB
Conjugation Unconjugated

More info

Polyclonal Antibody against Human KIF22, Gene description: kinesin family member 22, Alternative Gene Names: Kid, KNSL4, OBP-1, OBP-2, Validated applications: IHC, WB, Uniprot ID: Q14807, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image