Anti-VAC14 View larger

Anti-VAC14 Antibody 25ul

AN-HPA075382-25ul

New product

Anti-VAC14

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.


Data sheet

Size 25ul
Gene Name VAC14
Gene Description Vac14, PIKFYVE complex component
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, WB
Sequence IECPIFTYLRLQLLDVKNNPYLIKALYGLLMLLPQSSAFQLLSHRLQCVPNPELLQTEDSLKAAPKSQKADSPSIDYAELLQHFEKVQNKHLEV
Immunogen IECPIFTYLRLQLLDVKNNPYLIKALYGLLMLLPQSSAFQLLSHRLQCVPNPELLQTEDSLKAAPKSQKADSPSIDYAELLQHFEKVQNKHLEV
Product Group Polyclonal Antibodies
Alternative Names ArPIKfyve, FLJ10305, TAX1BP2
Category Polyclonal
Host RABBIT
UniProt ID Q08AM6
HTS Code 3002150000
Gene ID 55697
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Aplicativo WB, ICC
Conjugation Unconjugated

More info

Polyclonal Antibody against Human VAC14, Gene description: Vac14, PIKFYVE complex component, Alternative Gene Names: ArPIKfyve, FLJ10305, TAX1BP2, Validated applications: ICC, WB, Uniprot ID: Q08AM6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image