Anti-SMN1
  • Anti-SMN1

Anti-SMN1 Antibody 25ul

Ref: AN-HPA073601-25ul
Anti-SMN1

Información del producto

Polyclonal Antibody against Human SMN1, Gene description: survival of motor neuron 1, telomeric, Alternative Gene Names: BCD541, GEMIN1, SMA, SMA@, SMA1, SMA2, SMA3, SMNT, TDRD16A, Validated applications: ICC, WB, Uniprot ID: Q16637, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name SMN1
Gene Description survival of motor neuron 1, telomeric
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, WB
Sequence IDFKRETCVVVYTGYGNREEQNLSDLLSPICEVANNIEQNAQENENESQVSTDESENSRSPGNKSDNIKPKSAPWNSFLPPP
Immunogen IDFKRETCVVVYTGYGNREEQNLSDLLSPICEVANNIEQNAQENENESQVSTDESENSRSPGNKSDNIKPKSAPWNSFLPPP
Product Group Polyclonal Antibodies
Alternative Names BCD541, GEMIN1, SMA, SMA@, SMA1, SMA2, SMA3, SMNT, TDRD16A
Category Polyclonal
Host RABBIT
UniProt ID Q16637
HTS Code 3002150000
Gene ID 6606
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-SMN1 Antibody 25ul

Anti-SMN1 Antibody 25ul