Anti-KCNH5 View larger

Anti-KCNH5 Antibody 25ul

AN-HPA072351-25ul

New product

Anti-KCNH5

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.


Data sheet

Size 25ul
Gene Name KCNH5
Gene Description potassium voltage-gated channel subfamily H member 5
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence SLKQNNRDAMELKPNGGADQKCLKVNSPIRMKNGNGKGWLRLKNNMGAHEEKKEDWNNVTKAESMGLLSEDPKSSDSENSVTK
Immunogen SLKQNNRDAMELKPNGGADQKCLKVNSPIRMKNGNGKGWLRLKNNMGAHEEKKEDWNNVTKAESMGLLSEDPKSSDSENSVTK
Product Group Polyclonal Antibodies
Alternative Names eag2, H-EAG2, Kv10.2
Category Polyclonal
Host RABBIT
UniProt ID Q8NCM2
HTS Code 3002150000
Gene ID 27133
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Aplicativo ICC
Conjugation Unconjugated

More info

Polyclonal Antibody against Human KCNH5, Gene description: potassium voltage-gated channel subfamily H member 5, Alternative Gene Names: eag2, H-EAG2, Kv10.2, Validated applications: ICC, Uniprot ID: Q8NCM2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image