Anti-RPRD1B
  • Anti-RPRD1B

Anti-RPRD1B Antibody 25ul

Ref: AN-HPA070590-25ul
Anti-RPRD1B

Información del producto

Polyclonal Antibody against Human RPRD1B, Gene description: regulation of nuclear pre-mRNA domain containing 1B, Alternative Gene Names: C20orf77, CREPT, dJ1057B20.2, DKFZp434P0735, FLJ44520, K-H, Kub5-Hera, NET60, Validated applications: IHC, WB, Uniprot ID: Q9NQG5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name RPRD1B
Gene Description regulation of nuclear pre-mRNA domain containing 1B
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence RLAAELEDRRQLARMLVEYTQNQKDVLSEKEKK
Immunogen RLAAELEDRRQLARMLVEYTQNQKDVLSEKEKK
Product Group Polyclonal Antibodies
Alternative Names C20orf77, CREPT, dJ1057B20.2, DKFZp434P0735, FLJ44520, K-H, Kub5-Hera, NET60
Category Polyclonal
Host RABBIT
UniProt ID Q9NQG5
HTS Code 3002150000
Gene ID 58490
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-RPRD1B Antibody 25ul

Anti-RPRD1B Antibody 25ul