Anti-APBA2
  • Anti-APBA2

Anti-APBA2 Antibody 100ul

Ref: AN-HPA070376-100ul
Anti-APBA2

Información del producto

Polyclonal Antibody against Human APBA2, Gene description: amyloid beta precursor protein binding family A member 2, Alternative Gene Names: D15S1518E, HsT16821, LIN-10, MGC:14091, MINT2, X11L, Validated applications: ICC, Uniprot ID: Q99767, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name APBA2
Gene Description amyloid beta precursor protein binding family A member 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence AHRKLESVGSGMLDHRVRPGPVPHSQEPESEDMELPLEGYVPEGLELAALRPESPAPEEQECHNHSPDGDSSSDYVNNTSE
Immunogen AHRKLESVGSGMLDHRVRPGPVPHSQEPESEDMELPLEGYVPEGLELAALRPESPAPEEQECHNHSPDGDSSSDYVNNTSE
Product Group Polyclonal Antibodies
Alternative Names D15S1518E, HsT16821, LIN-10, MGC:14091, MINT2, X11L
Category Polyclonal
Host RABBIT
UniProt ID Q99767
HTS Code 3002150000
Gene ID 321
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-APBA2 Antibody 100ul

Anti-APBA2 Antibody 100ul