Anti-IL7R View larger

Anti-IL7R Antibody 100ul

AN-HPA067550-100ul

New product

Anti-IL7R

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.


Data sheet

Size 100ul
Gene Name IL7R
Gene Description interleukin 7 receptor
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, WB
Sequence HKKTLEHLCKKPRKNLNVSFNPESFLDCQIHRVDDIQARDEVEGFLQDTFPQQLEESEKQRLGGDVQSPNCPSEDVVITPES
Immunogen HKKTLEHLCKKPRKNLNVSFNPESFLDCQIHRVDDIQARDEVEGFLQDTFPQQLEESEKQRLGGDVQSPNCPSEDVVITPES
Product Group Polyclonal Antibodies
Alternative Names CD127
Category Polyclonal
Host RABBIT
UniProt ID P16871
HTS Code 3002150000
Gene ID 3575
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Aplicativo WB, ICC
Conjugation Unconjugated

More info

Polyclonal Antibody against Human IL7R, Gene description: interleukin 7 receptor, Alternative Gene Names: CD127, Validated applications: ICC, WB, Uniprot ID: P16871, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image