Anti-ODF3L2 View larger

Anti-ODF3L2 Antibody 100ul

AN-HPA067065-100ul

New product

Anti-ODF3L2

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 5 pontos de fidelização. Seu carrinho totalizará 5 pontos de fidelização que podem ser convertidos num vale de desconto de 20.00EUR.


Data sheet

Size 100ul
Gene Name ODF3L2
Gene Description outer dense fiber of sperm tails 3 like 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence EIPGPGQYDSPDANTYRQRLPAFTMLGRPRAPRPLEETPGPGAHCPEQVTVNKARAPAFSMGIRHSKRASTM
Immunogen EIPGPGQYDSPDANTYRQRLPAFTMLGRPRAPRPLEETPGPGAHCPEQVTVNKARAPAFSMGIRHSKRASTM
Product Group Polyclonal Antibodies
Alternative Names C19orf19, FLJ40059
Category Polyclonal
Host RABBIT
UniProt ID Q3SX64
HTS Code 3002150000
Gene ID 284451
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Aplicativo ICC
Conjugation Unconjugated

More info

Polyclonal Antibody against Human ODF3L2, Gene description: outer dense fiber of sperm tails 3 like 2, Alternative Gene Names: C19orf19, FLJ40059, Validated applications: ICC, Uniprot ID: Q3SX64, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image