Anti-EGFLAM
  • Anti-EGFLAM

Anti-EGFLAM Antibody 25ul

Ref: AN-HPA066577-25ul
Anti-EGFLAM

Información del producto

Polyclonal Antibody against Human EGFLAM, Gene description: EGF like, fibronectin type III and laminin G domains, Alternative Gene Names: AGRINL, AGRNL, FLJ39155, PIKA, Validated applications: IHC, WB, Uniprot ID: Q63HQ2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name EGFLAM
Gene Description EGF like, fibronectin type III and laminin G domains
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence GNWHELRVSRTAKNGILQVDKQKIVEGMAEGGFTQIKCNTDIFIGGVPNYDDVKKNSGVLKPFSGSIQKIILNDRTIHVKHDFTSGVNVENA
Immunogen GNWHELRVSRTAKNGILQVDKQKIVEGMAEGGFTQIKCNTDIFIGGVPNYDDVKKNSGVLKPFSGSIQKIILNDRTIHVKHDFTSGVNVENA
Product Group Polyclonal Antibodies
Alternative Names AGRINL, AGRNL, FLJ39155, PIKA
Category Polyclonal
Host RABBIT
UniProt ID Q63HQ2
HTS Code 3002150000
Gene ID 133584
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-EGFLAM Antibody 25ul

Anti-EGFLAM Antibody 25ul