View larger
Anti-NDUFB8 Antibody 25ul
AN-HPA065549-25ul
New product
Anti-NDUFB8
Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.
Data sheet
| Size | 25ul |
| Gene Name | NDUFB8 |
| Gene Description | NADH:ubiquinone oxidoreductase subunit B8 |
| Storage Conditions | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Shipping Conditions | Normally shipped at ambient temperature |
| Species Reactivity Cross | Human |
| Applications | WB |
| Sequence | YPVYQPVGPKQYPYNNLYLERGGDPSKEPERVVHYEI |
| Immunogen | YPVYQPVGPKQYPYNNLYLERGGDPSKEPERVVHYEI |
| Product Group | Polyclonal Antibodies |
| Alternative Names | ASHI, CI-ASHI |
| Category | Polyclonal |
| Host | RABBIT |
| UniProt ID | O95169 |
| HTS Code | 3002150000 |
| Gene ID | 4714 |
| Buffer Formulation | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purification | Affinity purified using the PrEST antigen as affinity ligand |
| Iso type | IgG |
| Aplicativo | WB |
| Conjugation | Unconjugated |
More info
Polyclonal Antibody against Human NDUFB8, Gene description: NADH:ubiquinone oxidoreductase subunit B8, Alternative Gene Names: ASHI, CI-ASHI, Validated applications: WB, Uniprot ID: O95169, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C." target="_blank">See DataSheet herehttps://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF