Anti-ADAMTS13
  • Anti-ADAMTS13

Anti-ADAMTS13 Antibody 100ul

Ref: AN-HPA052077-100ul
Anti-ADAMTS13

Información del producto

Polyclonal Antibody against Human ADAMTS13, Gene description: ADAM metallopeptidase with thrombospondin type 1 motif 13, Alternative Gene Names: C9orf8, DKFZp434C2322, FLJ42993, MGC118899, MGC118900, TTP, vWF-CP, VWFCP, Validated applications: ICC, Uniprot ID: Q76LX8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name ADAMTS13
Gene Description ADAM metallopeptidase with thrombospondin type 1 motif 13
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence RYGSQLAPETFYRECDMQLFGPWGEIVSPSLSPATSNAGGCRLFINVAPHARIAIHALATNMGAGTEGANASYILIRDTHSLRTTAFHGQQV
Immunogen RYGSQLAPETFYRECDMQLFGPWGEIVSPSLSPATSNAGGCRLFINVAPHARIAIHALATNMGAGTEGANASYILIRDTHSLRTTAFHGQQV
Product Group Polyclonal Antibodies
Alternative Names C9orf8, DKFZp434C2322, FLJ42993, MGC118899, MGC118900, TTP, vWF-CP, VWFCP
Category Polyclonal
Host RABBIT
UniProt ID Q76LX8
HTS Code 3002150000
Gene ID 11093
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-ADAMTS13 Antibody 100ul

Anti-ADAMTS13 Antibody 100ul