MAN2A2,HsT19662
  • MAN2A2,HsT19662

Anti-MAN2A2 Antibody 100ul

Ref: AN-HPA077930-100ul
Anti-MAN2A2

Información del producto

Polyclonal Antibody against Human MAN2A2, Gene description: mannosidase alpha class 2A member 2, Alternative Gene Names: HsT19662, MANA2X, Validated applications: ICC, Uniprot ID: P49641, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name MAN2A2
Gene Description mannosidase alpha class 2A member 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence TLPSSVRIYLHGRQLSVSRHEAFPLRVIDSGTSDFALSNRYMQVWFSGLTGLLKSIRRVDEEHEQQVDMQVLVYGTRTSKD
Immunogen TLPSSVRIYLHGRQLSVSRHEAFPLRVIDSGTSDFALSNRYMQVWFSGLTGLLKSIRRVDEEHEQQVDMQVLVYGTRTSKD
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names HsT19662, MANA2X
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P49641
HTS Code 3002150000
Gene ID 4122
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-MAN2A2 Antibody 100ul

Anti-MAN2A2 Antibody 100ul