MTFP1,HSPC242,MTP18
  • MTFP1,HSPC242,MTP18

Anti-MTFP1 Antibody 100ul

Ref: AN-HPA077396-100ul
Anti-MTFP1

Información del producto

Polyclonal Antibody against Human MTFP1, Gene description: mitochondrial fission process 1, Alternative Gene Names: HSPC242, MTP18, Validated applications: ICC, Uniprot ID: Q9UDX5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name MTFP1
Gene Description mitochondrial fission process 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence CFMSTSYSCQGMWTPGSLVSKDPGTWVGLSWTEA
Immunogen CFMSTSYSCQGMWTPGSLVSKDPGTWVGLSWTEA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names HSPC242, MTP18
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9UDX5
HTS Code 3002150000
Gene ID 51537
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-MTFP1 Antibody 100ul

Anti-MTFP1 Antibody 100ul