PCDHGC3,PC-43,PC43
  • PCDHGC3,PC-43,PC43

Anti-PCDHGC3 Antibody 25ul

Ref: AN-HPA077289-25ul
Anti-PCDHGC3

Información del producto

Polyclonal Antibody against Human PCDHGC3, Gene description: protocadherin gamma subfamily C, 3, Alternative Gene Names: PC-43, PC43, PCDH-GAMMA-C3, PCDH2, Validated applications: ICC, Uniprot ID: Q9UN70, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name PCDHGC3
Gene Description protocadherin gamma subfamily C, 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence YKWKQSRDLYRAPVSSLYRTPGPSLHADAVRGGLMSPHLYHQVYLTTDSRRSDPLLKKPGAASPLASRQNTLRSCDPVFYRQVLGAES
Immunogen YKWKQSRDLYRAPVSSLYRTPGPSLHADAVRGGLMSPHLYHQVYLTTDSRRSDPLLKKPGAASPLASRQNTLRSCDPVFYRQVLGAES
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names PC-43, PC43, PCDH-GAMMA-C3, PCDH2
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9UN70
HTS Code 3002150000
Gene ID 5098
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-PCDHGC3 Antibody 25ul

Anti-PCDHGC3 Antibody 25ul