KLRG1,2F1,CLEC15A
  • KLRG1,2F1,CLEC15A

Anti-KLRG1 Antibody 25ul

Ref: AN-HPA076494-25ul
Anti-KLRG1

Información del producto

Polyclonal Antibody against Human KLRG1, Gene description: killer cell lectin-like receptor subfamily G, member 1, Alternative Gene Names: 2F1, CLEC15A, MAFA, MAFA-L, Validated applications: WB, Uniprot ID: Q96E93, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name KLRG1
Gene Description killer cell lectin-like receptor subfamily G, member 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB
Sequence LCQGSNYSTCASCPSCPDRWMKYGNHCYYFSVEEKDWNSSLEFCLARDSHLLVITDNQEMSLLQVFLSE
Immunogen LCQGSNYSTCASCPSCPDRWMKYGNHCYYFSVEEKDWNSSLEFCLARDSHLLVITDNQEMSLLQVFLSE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names 2F1, CLEC15A, MAFA, MAFA-L
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96E93
HTS Code 3002150000
Gene ID 10219
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-KLRG1 Antibody 25ul

Anti-KLRG1 Antibody 25ul