ZNF541,DKFZp434I1930
  • ZNF541,DKFZp434I1930

Anti-ZNF541 Antibody 25ul

Ref: AN-HPA076453-25ul
Anti-ZNF541

Información del producto

Polyclonal Antibody against Human ZNF541, Gene description: zinc finger protein 541, Alternative Gene Names: DKFZp434I1930, Validated applications: IHC, Uniprot ID: Q9H0D2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name ZNF541
Gene Description zinc finger protein 541
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence PKKVKVDCDSFLCQNPGEPGLQEAQKAGGLPADASPLFRQLFLKSQEPLVSHEQMQVFQMITKSQRIFSHAQV
Immunogen PKKVKVDCDSFLCQNPGEPGLQEAQKAGGLPADASPLFRQLFLKSQEPLVSHEQMQVFQMITKSQRIFSHAQV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DKFZp434I1930
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9H0D2
HTS Code 3002150000
Gene ID 84215
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-ZNF541 Antibody 25ul

Anti-ZNF541 Antibody 25ul