JPH3,CAGL237,HDL2
  • JPH3,CAGL237,HDL2

Anti-JPH3 Antibody 100ul

Ref: AN-HPA076304-100ul
Anti-JPH3

Información del producto

Polyclonal Antibody against Human JPH3, Gene description: junctophilin 3, Alternative Gene Names: CAGL237, HDL2, JP-3, JP3, TNRC22, Validated applications: ICC, Uniprot ID: Q8WXH2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name JPH3
Gene Description junctophilin 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence KRRYSKGGACRGLGDDHRPEDRGFGVQRLRSKAQNKENFRPASSAEPAVQKLASLRLGGAEPRLLRWDLTF
Immunogen KRRYSKGGACRGLGDDHRPEDRGFGVQRLRSKAQNKENFRPASSAEPAVQKLASLRLGGAEPRLLRWDLTF
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CAGL237, HDL2, JP-3, JP3, TNRC22
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8WXH2
HTS Code 3002150000
Gene ID 57338
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-JPH3 Antibody 100ul

Anti-JPH3 Antibody 100ul