PCDHAC2
  • PCDHAC2

Anti-PCDHAC2 Antibody 25ul

Ref: AN-HPA076190-25ul
Anti-PCDHAC2

Información del producto

Polyclonal Antibody against Human PCDHAC2, Gene description: protocadherin alpha subfamily C, 2, Alternative Gene Names: PCDH-ALPHA-C2, Validated applications: ICC, Uniprot ID: Q9Y5I4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name PCDHAC2
Gene Description protocadherin alpha subfamily C, 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence CGVRERSPAELYKQANNNIDARIPHGLKVQPHFIEVRGNGSLTKTYCYKACLTAGSGSDTFMFYNTGAQTGPGPSGAQAAVTDSRNLTGQSGQNAGNLII
Immunogen CGVRERSPAELYKQANNNIDARIPHGLKVQPHFIEVRGNGSLTKTYCYKACLTAGSGSDTFMFYNTGAQTGPGPSGAQAAVTDSRNLTGQSGQNAGNLII
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names PCDH-ALPHA-C2
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9Y5I4
HTS Code 3002150000
Gene ID 56134
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-PCDHAC2 Antibody 25ul

Anti-PCDHAC2 Antibody 25ul