S1PR1,CD363,D1S3362
  • S1PR1,CD363,D1S3362

Anti-S1PR1 Antibody 25ul

Ref: AN-HPA075568-25ul
Anti-S1PR1

Información del producto

Polyclonal Antibody against Human S1PR1, Gene description: sphingosine-1-phosphate receptor 1, Alternative Gene Names: CD363, D1S3362, edg-1, EDG1, Validated applications: ICC, Uniprot ID: P21453, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name S1PR1
Gene Description sphingosine-1-phosphate receptor 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence MGPTSVPLVKAHRSSVSDYVNYDIIVRHYNYT
Immunogen MGPTSVPLVKAHRSSVSDYVNYDIIVRHYNYT
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CD363, D1S3362, edg-1, EDG1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P21453
HTS Code 3002150000
Gene ID 1901
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-S1PR1 Antibody 25ul

Anti-S1PR1 Antibody 25ul