DYRK3,hYAK3-2,RED
  • DYRK3,hYAK3-2,RED

Anti-DYRK3 Antibody 25ul

Ref: AN-HPA075041-25ul
Anti-DYRK3

Información del producto

Polyclonal Antibody against Human DYRK3, Gene description: dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 3, Alternative Gene Names: hYAK3-2, RED, REDK, Validated applications: ICC, Uniprot ID: O43781, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name DYRK3
Gene Description dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence GVYDTFMMIDETKCPPCSNVLCNPSEPPPPRRLNMTTEQFTGDHTQHFLDGGEMKVEQLFQEFGNRKSNTIQ
Immunogen GVYDTFMMIDETKCPPCSNVLCNPSEPPPPRRLNMTTEQFTGDHTQHFLDGGEMKVEQLFQEFGNRKSNTIQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names hYAK3-2, RED, REDK
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O43781
HTS Code 3002150000
Gene ID 8444
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-DYRK3 Antibody 25ul

Anti-DYRK3 Antibody 25ul