INTS3,C1orf60
  • INTS3,C1orf60

Anti-INTS3 Antibody 100ul

Ref: AN-HPA074391-100ul
Anti-INTS3

Información del producto

Polyclonal Antibody against Human INTS3, Gene description: integrator complex subunit 3, Alternative Gene Names: C1orf60, FLJ21919, INT3, SOSS-A, Validated applications: ICC, IHC, Uniprot ID: Q68E01, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name INTS3
Gene Description integrator complex subunit 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence LEHLDNLRLNLTNTKQNFFSQTPILQALQHVQASCDEAHKMKFSDLFSLAEEYEDSSTKPPKSRRKAALSSPRSRKNATQP
Immunogen LEHLDNLRLNLTNTKQNFFSQTPILQALQHVQASCDEAHKMKFSDLFSLAEEYEDSSTKPPKSRRKAALSSPRSRKNATQP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C1orf60, FLJ21919, INT3, SOSS-A
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q68E01
HTS Code 3002150000
Gene ID 65123
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-INTS3 Antibody 100ul

Anti-INTS3 Antibody 100ul