PTRF,cavin-1,CAVIN1
  • PTRF,cavin-1,CAVIN1

Anti-PTRF Antibody 25ul

Ref: AN-HPA074213-25ul
Anti-PTRF

Información del producto

Polyclonal Antibody against Human PTRF, Gene description: polymerase I and transcript release factor, Alternative Gene Names: cavin-1, CAVIN1, Validated applications: ICC, Uniprot ID: Q6NZI2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name PTRF
Gene Description polymerase I and transcript release factor
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence VSVNVKTVRGSLERQAGQIKKLEVNEAELLRRRNFKVMIYQDEVKLPAKLSISKSLKESEALPEKEGEELGEGERPEEDAAALELSSD
Immunogen VSVNVKTVRGSLERQAGQIKKLEVNEAELLRRRNFKVMIYQDEVKLPAKLSISKSLKESEALPEKEGEELGEGERPEEDAAALELSSD
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names cavin-1, CAVIN1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q6NZI2
HTS Code 3002150000
Gene ID 284119
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-PTRF Antibody 25ul

Anti-PTRF Antibody 25ul