ADAM28,ADAM23
  • ADAM28,ADAM23

Anti-ADAM28 Antibody 25ul

Ref: AN-HPA074034-25ul
Anti-ADAM28

Información del producto

Polyclonal Antibody against Human ADAM28, Gene description: ADAM metallopeptidase domain 28, Alternative Gene Names: ADAM23, eMDCII, MDC-Lm, MDC-Ls, Validated applications: ICC, IHC, Uniprot ID: Q9UKQ2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name ADAM28
Gene Description ADAM metallopeptidase domain 28
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence ELPGVKKYEVVYPIRLHPLHKREAKEPEQQEQFETELKYKMTINGKIAVLYLKKNKNLLAPGYTETYYNSTGKEITTSPQIMDDCYY
Immunogen ELPGVKKYEVVYPIRLHPLHKREAKEPEQQEQFETELKYKMTINGKIAVLYLKKNKNLLAPGYTETYYNSTGKEITTSPQIMDDCYY
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ADAM23, eMDCII, MDC-Lm, MDC-Ls
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9UKQ2
HTS Code 3002150000
Gene ID 10863
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-ADAM28 Antibody 25ul

Anti-ADAM28 Antibody 25ul