LHX1,LIM-1,LIM1
  • LHX1,LIM-1,LIM1

Anti-LHX1 Antibody 100ul

Ref: AN-HPA073521-100ul
Anti-LHX1

Información del producto

Polyclonal Antibody against Human LHX1, Gene description: LIM homeobox 1, Alternative Gene Names: LIM-1, LIM1, Validated applications: IHC, Uniprot ID: P48742, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name LHX1
Gene Description LIM homeobox 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence NGPFSFYGDYQSEYYGPGGNYDFFPQGPPSSQAQTPVDLPFVPSSGPSGTPLGGLEHPLPGHHPSSEAQRFTDILAHPPGDSPSPEPSLPGPLHSMSAEVFGPSPPFSSLSVNGGASYGNHL
Immunogen NGPFSFYGDYQSEYYGPGGNYDFFPQGPPSSQAQTPVDLPFVPSSGPSGTPLGGLEHPLPGHHPSSEAQRFTDILAHPPGDSPSPEPSLPGPLHSMSAEVFGPSPPFSSLSVNGGASYGNHL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names LIM-1, LIM1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P48742
HTS Code 3002150000
Gene ID 3975
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-LHX1 Antibody 100ul

Anti-LHX1 Antibody 100ul