MPIG6B,C6orf25,G6b
  • MPIG6B,C6orf25,G6b

Anti-MPIG6B Antibody 100ul

Ref: AN-HPA073017-100ul
Anti-MPIG6B

Información del producto

Polyclonal Antibody against Human MPIG6B, Gene description: megakaryocyte and platelet inhibitory receptor G6b, Alternative Gene Names: C6orf25, G6b, G6b-B, NG31, Validated applications: ICC, Uniprot ID: O95866, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name MPIG6B
Gene Description megakaryocyte and platelet inhibitory receptor G6b
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence DRVNLSCGGVSHPIRWVWAPSFPACKGLSKGRRPILWASSSGTPTVPPLQPFVGR
Immunogen DRVNLSCGGVSHPIRWVWAPSFPACKGLSKGRRPILWASSSGTPTVPPLQPFVGR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C6orf25, G6b, G6b-B, NG31
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O95866
HTS Code 3002150000
Gene ID 80739
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-MPIG6B Antibody 100ul

Anti-MPIG6B Antibody 100ul