YTHDC2,DKFZp564A186
  • YTHDC2,DKFZp564A186

Anti-YTHDC2 Antibody 100ul

Ref: AN-HPA072678-100ul
Anti-YTHDC2

Información del producto

Polyclonal Antibody against Human YTHDC2, Gene description: YTH domain containing 2, Alternative Gene Names: DKFZp564A186, FLJ10053, FLJ2194, Validated applications: ICC, Uniprot ID: Q9H6S0, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name YTHDC2
Gene Description YTH domain containing 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence TVLNVTDEYDLLDDGGDAVFSQLTEKDVNCLEPWLIKEMDACLSDIWLHKDIDAFAQVFHLILTENVSVDYRHSETSATA
Immunogen TVLNVTDEYDLLDDGGDAVFSQLTEKDVNCLEPWLIKEMDACLSDIWLHKDIDAFAQVFHLILTENVSVDYRHSETSATA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DKFZp564A186, FLJ10053, FLJ2194
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9H6S0
HTS Code 3002150000
Gene ID 64848
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-YTHDC2 Antibody 100ul

Anti-YTHDC2 Antibody 100ul