YEATS4,GAS41,NuBI-1
  • YEATS4,GAS41,NuBI-1

Anti-YEATS4 Antibody 100ul

Ref: AN-HPA072532-100ul
Anti-YEATS4

Información del producto

Polyclonal Antibody against Human YEATS4, Gene description: YEATS domain containing 4, Alternative Gene Names: GAS41, NuBI-1, YAF9, Validated applications: ICC, Uniprot ID: O95619, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name YEATS4
Gene Description YEATS domain containing 4
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence QQLLTTSRQLTLGAYKHETEFAELEVKTREKLEAAKKKTSFEIAELKERLKASRETINCLKNEIRKLEEDDQAKD
Immunogen QQLLTTSRQLTLGAYKHETEFAELEVKTREKLEAAKKKTSFEIAELKERLKASRETINCLKNEIRKLEEDDQAKD
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names GAS41, NuBI-1, YAF9
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O95619
HTS Code 3002150000
Gene ID 8089
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-YEATS4 Antibody 100ul

Anti-YEATS4 Antibody 100ul