MAIP1,C2orf47
  • MAIP1,C2orf47

Anti-MAIP1 Antibody 25ul

Ref: AN-HPA072231-25ul
Anti-MAIP1

Información del producto

Polyclonal Antibody against Human MAIP1, Gene description: matrix AAA peptidase interacting protein 1, Alternative Gene Names: C2orf47, DKFZp666A212, FLJ22555, Validated applications: IHC, Uniprot ID: Q8WWC4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name MAIP1
Gene Description matrix AAA peptidase interacting protein 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence FAHVSKLLSQCKFDLLEELVAKEVLHALKEKVTSLPDNHKNALAANIDEIV
Immunogen FAHVSKLLSQCKFDLLEELVAKEVLHALKEKVTSLPDNHKNALAANIDEIV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C2orf47, DKFZp666A212, FLJ22555
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8WWC4
HTS Code 3002150000
Gene ID 79568
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-MAIP1 Antibody 25ul

Anti-MAIP1 Antibody 25ul